PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G124200.1.p
Common NameSETIT_022624mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 341aa    MW: 35539.1 Da    PI: 9.0493
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G124200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding414.4e-13181225347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +W++eE+ l++++  +lG g+W+ I+r + ++Rt+ q+ s+ qk+
  Seita.3G124200.1.p 181 PWSEEEHRLFLEGLDKLGRGDWRGISRGFVTTRTPTQVASHAQKF 225
                         8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.029174230IPR017930Myb domain
SuperFamilySSF466891.2E-16176231IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-17177229IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.2E-10178221IPR009057Homeodomain-like
SMARTSM007174.6E-10178228IPR001005SANT/Myb domain
CDDcd001675.63E-9181226No hitNo description
PfamPF002492.5E-10181224IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MAIYIPATAM AVLLGNNFSK EFRIGIAFLF IHAMHTVASR CSRCGGCGHS SIACRVAATA  60
CQRGSEAATM RCGGGGAAAG LRLFGVQLGA ASTSGGGASP ALQLHKSYSV DCLNLQACSA  120
PAYALVAAPL LLSPSRSSAL LLSIDECSTG RATDGGSGGG YLSDDGGRGG AALRERKKGV  180
PWSEEEHRLF LEGLDKLGRG DWRGISRGFV TTRTPTQVAS HAQKFFLRQS SAGKKSSTKR  240
RSSLFDMVQN CESGRDVVLV SDASDGKAAS TSNSVSPKAP RDVYRKESTA IHERTTIRPS  300
SERDSVSETV TVTTEQAHGY HCSPLNLELG MSLSTPSIGT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961036.20.0PREDICTED: transcription factor MYB1R1-like
TrEMBLK3Z7V40.0K3Z7V4_SETIT; Uncharacterized protein
STRINGSi022624m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49323066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.18e-35MYB_related family protein